PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc01469.1.g00050.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 557aa    MW: 60209.6 Da    PI: 6.5909
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc01469.1.g00050.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY932.3e-29237293259
                                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                      Dg+nWrKYGqK+vk+s+++rsYYrCt +gC +k+kve++  d++vvei+Y+g+Hnhe
  Zpz_sc01469.1.g00050.1.sm.mkhc 237 ADGFNWRKYGQKQVKSSDNSRSYYRCTNSGCLAKRKVEHCP-DGRVVEIIYRGTHNHE 293
                                     7****************************************.***************8 PP

2WRKY33.11.1e-10407427222
                                     --SS-EEEEEEE--TT-SS-E CS
                            WRKY   2 dDgynWrKYGqKevkgsefpr 22 
                                     +Dgy+WrKYGqK vkg+++pr
  Zpz_sc01469.1.g00050.1.sm.mkhc 407 NDGYRWRKYGQKIVKGNPNPR 427
                                     8*******************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081122.022231295IPR003657WRKY domain
Gene3DG3DSA:2.20.25.809.9E-26231295IPR003657WRKY domain
SuperFamilySSF1182905.75E-23233295IPR003657WRKY domain
SMARTSM007742.0E-31236294IPR003657WRKY domain
PfamPF031063.0E-22238293IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-9399427IPR003657WRKY domain
SuperFamilySSF1182903.14E-8401428IPR003657WRKY domain
PROSITE profilePS5081113.196401427IPR003657WRKY domain
SMARTSM007740.0018406452IPR003657WRKY domain
PfamPF031062.7E-7407429IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 557 aa     Download sequence    Send to blast
MAAGDPEPEP AVEKRPSPEE AAAAAEAEET RPPPAEAPQS PAEENPPAPE AVAEGDTRPR  60
PKPPGPPPPG FYAYSELHVA KNEAKEVKAE DKVEKEKMKE KVEAKVVEVA EVKVEGKEKG  120
VRPARRPAGS SAEAPILAVP MVAVPCFIAP PGFPGQFVMS QQTALASITA QAQMQLQSPT  180
SSVNSEAPSS PFYIAQKAIM PHQQAPSGTE GTICTPTADK LSSSESKLHH NVVNMVADGF  240
NWRKYGQKQV KSSDNSRSYY RCTNSGCLAK RKVEHCPDGR VVEIIYRGTH NHEPPQKTRF  300
AKGRVPSIHV PSGGETVRLV HTEIVDSRTP TYNDQSTVTE TSENASEQQL FCSSDCEGDA  360
GNRSEDEHPS PEPLPKRRTV ELSSPNFAPL LRTVREQKIV VQAGKINDGY RWRKYGQKIV  420
KGNPNPRWVL LLSNGVITAV LMVDVLYFVY EMRAGIEALG SGCHGPGSVE PTESSRRDDP  480
ACALYIAANA KVGAGSNPFT AFFTASTSMS TSFPVADVMT VQLPLSSAYG RNRLAFSAEE  540
NSATLEKEQS RAWNGIT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973142.11e-176PREDICTED: probable WRKY transcription factor 32
TrEMBLK3YGX01e-176K3YGX0_SETIT; Uncharacterized protein
STRINGSi013488m1e-175(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP58203455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.15e-46WRKY DNA-binding protein 4